PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.34053s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 184aa    MW: 20338.4 Da    PI: 9.0228
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.34053s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.9e-3945105262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvP+Ggg+rk k+s+
  Araha.34053s0001.1.p  45 HHQSLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPIGGGCRKAKRSK 105
                           57899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3536103IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3347103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.43249103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MQDIHDYSMT GVGGGGGRFF GGGMGGGGGG GDRRMRAHQN NILNHHQSLK CPRCNSLNTK  60
FCYYNNYNLS QPRHFCKNCR RYWTKGGVLR NVPIGGGCRK AKRSKTKQLE GETVQQQQFG  120
DRTAQVEFQG RSSDPNMGFE PLDWGSGGGD QTLFDLTSTV DHAYWSQSQW TSSDQDQNGL  180
YLP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11522GGRFFGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0154721e-126AB015472.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MAE1.
GenBankAK2272471e-126AK227247.1 Arabidopsis thaliana mRNA for zinc finger protein OBP4 - like, complete cds, clone: RAFL11-02-A14.
GenBankAY0564131e-126AY056413.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBankAY0817091e-126AY081709.1 Arabidopsis thaliana AT5g60850/mae1_100 mRNA, complete cds.
GenBankAY0858561e-126AY085856.1 Arabidopsis thaliana clone 19080 mRNA, complete sequence.
GenBankCP0026881e-126CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599441.11e-55PREDICTED: dof zinc finger protein DOF5.4
RefseqXP_013730935.11e-55PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR02e-55DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A0D3DDF41e-55A0A0D3DDF4_BRAOL; Uncharacterized protein
STRINGBra013003.1-P4e-55(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-56OBF binding protein 4